Lineage for d2ga6k1 (2ga6 K:9-129)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 752141Fold g.86: Coronavirus NSP10-like [144245] (1 superfamily)
    binds two zinc ion per subunit; forms a dodecameric shell
  4. 752142Superfamily g.86.1: Coronavirus NSP10-like [144246] (1 family) (S)
  5. 752143Family g.86.1.1: Coronavirus NSP10-like [144247] (1 protein)
    partly covered by PfamB 001266
  6. 752144Protein Nonstructural protein 10, NSP10 [144248] (1 species)
  7. 752145Species SARS coronavirus [TaxId:227859] [144249] (3 PDB entries)
  8. 752181Domain d2ga6k1: 2ga6 K:9-129 [134871]
    automatically matched to 2G9T A:9-129
    complexed with zn

Details for d2ga6k1

PDB Entry: 2ga6 (more details), 2.7 Å

PDB Description: the crystal structure of sars nsp10 without zinc ion as additive
PDB Compounds: (K:) orf1a polyprotein

SCOP Domain Sequences for d2ga6k1:

Sequence, based on SEQRES records: (download)

>d2ga6k1 g.86.1.1 (K:9-129) Nonstructural protein 10, NSP10 {SARS coronavirus [TaxId: 227859]}
anstvlsfcafavdpakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesf
ggascclycrchidhpnpkgfcdlkgkyvqipttcandpvgftlrntvctvcgmwkgygc
s

Sequence, based on observed residues (ATOM records): (download)

>d2ga6k1 g.86.1.1 (K:9-129) Nonstructural protein 10, NSP10 {SARS coronavirus [TaxId: 227859]}
anstvlsfcafavdpakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesf
ggascclycrchidhpnfcdlkgkyvqipttcandpvgftlrntvctvcgmwkgygcs

SCOP Domain Coordinates for d2ga6k1:

Click to download the PDB-style file with coordinates for d2ga6k1.
(The format of our PDB-style files is described here.)

Timeline for d2ga6k1: