SCOPe 2.08: Domain d2ga6h_: 2ga6 H:

Lineage for d2ga6h_ (2ga6 H:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.86: Coronavirus NSP10-like [144245] (1 superfamily)
   binds two zinc ion per subunit; forms a dodecameric shell

4. Superfamily g.86.1: Coronavirus NSP10-like [144246] (1 family)
   automatically mapped to Pfam PF09401

5. Family g.86.1.1: Coronavirus NSP10-like [144247] (2 proteins)
   partly covered by PfamB PB001266

6. Protein Nonstructural protein 10, NSP10 [144248] (2 species)

7. Species SARS coronavirus [TaxId:227859] [144249] (3 PDB entries)
   Uniprot P59641 4239-4359! Uniprot P59641 4240-4362

8. Domain d2ga6h_: 2ga6 H: [134868]
   automated match to d2g9ta1
   complexed with zn

Details for d2ga6h_

PDB Entry: 2ga6, 2.7 Å

PDB Description: the crystal structure of sars nsp10 without zinc ion as additive

PDB Compounds: (H:) orf1a polyprotein

SCOPe Domain Sequences for d2ga6h_:

Sequence, based on SEQRES records:

>d2ga6h_ g.86.1.1 (H:) Nonstructural protein 10, NSP10 {SARS coronavirus [TaxId: 227859]}
anstvlsfcafavdpakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesf
ggascclycrchidhpnpkgfcdlkgkyvqipttcandpvgftlrntvctvcgmwkgygc
s

Sequence, based on observed residues (ATOM records):

>d2ga6h_ g.86.1.1 (H:) Nonstructural protein 10, NSP10 {SARS coronavirus [TaxId: 227859]}
anstvlsfcafavdpakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesf
ggascclycrchidhpnfcdlkgkyvqipttcandpvgftlrntvctvcgmwkgygcs

Timeline for d2ga6h_:

• d2ga6h_ first appeared in SCOP 1.73, called d2ga6h1
  
• d2ga6h_ appears in SCOPe 2.07