Lineage for d2ga4f1 (2ga4 F:1-70)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 667366Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 667367Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 667664Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (3 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 667793Species Shigella dysenteriae, toxin II [TaxId:622] [101755] (2 PDB entries)
  8. 667803Domain d2ga4f1: 2ga4 F:1-70 [134859]
    Other proteins in same PDB: d2ga4a1
    automatically matched to d1r4pb_
    complexed with 1ps, ade, edo, fmt, na

Details for d2ga4f1

PDB Entry: 2ga4 (more details), 1.8 Å

PDB Description: stx2 with adenine
PDB Compounds: (F:) Shiga-like toxin II subunit B

SCOP Domain Sequences for d2ga4f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ga4f1 b.40.2.1 (F:1-70) Verotoxin-1/shiga-toxin, B-pentamer {Shigella dysenteriae, toxin II [TaxId: 622]}
adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
gfaevqfnnd

SCOP Domain Coordinates for d2ga4f1:

Click to download the PDB-style file with coordinates for d2ga4f1.
(The format of our PDB-style files is described here.)

Timeline for d2ga4f1: