![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
![]() | Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
![]() | Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species) phage-borne toxin; bacteriophages H30 and H19B |
![]() | Species Enterobacteria phage [TaxId:10730] [187110] (1 PDB entry) |
![]() | Domain d2ga4f_: 2ga4 F: [134859] Other proteins in same PDB: d2ga4a_ automated match to d1r4pb_ complexed with 1ps, ade, edo, fmt, na |
PDB Entry: 2ga4 (more details), 1.8 Å
SCOPe Domain Sequences for d2ga4f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ga4f_ b.40.2.1 (F:) Verotoxin-1/shiga-toxin, B-pentamer {Enterobacteria phage [TaxId: 10730]} adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs gfaevqfnnd
Timeline for d2ga4f_: