![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.40: OB-fold [50198] (12 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) ![]() |
![]() | Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins) |
![]() | Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (3 species) phage-borne toxin; bacteriophages H30 and H19B |
![]() | Species Shigella dysenteriae, toxin II [TaxId:622] [101755] (2 PDB entries) |
![]() | Domain d2ga4e1: 2ga4 E:1-70 [134858] Other proteins in same PDB: d2ga4a1 automatically matched to d1r4pb_ complexed with 1ps, ade, edo, fmt, na |
PDB Entry: 2ga4 (more details), 1.8 Å
SCOP Domain Sequences for d2ga4e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ga4e1 b.40.2.1 (E:1-70) Verotoxin-1/shiga-toxin, B-pentamer {Shigella dysenteriae, toxin II [TaxId: 622]} adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs gfaevqfnnd
Timeline for d2ga4e1: