SCOPe 2.07: Domain d2ga4b_: 2ga4 B:

Lineage for d2ga4b_ (2ga4 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)

6. Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species)
   phage-borne toxin; bacteriophages H30 and H19B

7. Species Enterobacteria phage [TaxId:10730] [187110] (1 PDB entry)

8. Domain d2ga4b_: 2ga4 B: [134855]
   Other proteins in same PDB: d2ga4a_
   automated match to d1r4pb_
   complexed with 1ps, ade, edo, fmt, na

Details for d2ga4b_

PDB Entry: 2ga4, 1.8 Å

PDB Description: stx2 with adenine

PDB Compounds: (B:) Shiga-like toxin II subunit B

SCOPe Domain Sequences for d2ga4b_:

Sequence; same for both SEQRES and ATOM records:

>d2ga4b_ b.40.2.1 (B:) Verotoxin-1/shiga-toxin, B-pentamer {Enterobacteria phage [TaxId: 10730]}
adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
gfaevqfnnd

Timeline for d2ga4b_:

• d2ga4b_ first appeared in SCOP 1.73, called d2ga4b1
  
• d2ga4b_ appears in SCOPe 2.06
  
• d2ga4b_ appears in the current release, SCOPe 2.08