SCOP 1.73: Domain d2ga2a2: 2ga2 A:110-374,A:449-478

Lineage for d2ga2a2 (2ga2 A:110-374,A:449-478)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)

6. Protein Methionine aminopeptidase [55924] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55927] (16 PDB entries)
   methionine aminopeptidase 2 contains insert domain with a circularly permuted "winged helix" fold

8. Domain d2ga2a2: 2ga2 A:110-374,A:449-478 [134853]
   Other proteins in same PDB: d2ga2a1
   automatically matched to d1b59a2
   complexed with a19, mn

Details for d2ga2a2

PDB Entry: 2ga2, 1.95 Å

PDB Description: h-MetAP2 complexed with A193400

PDB Compounds: (A:) Methionine aminopeptidase 2

SCOP Domain Sequences for d2ga2a2:

Sequence; same for both SEQRES and ATOM records:

>d2ga2a2 d.127.1.1 (A:110-374,A:449-478) Methionine aminopeptidase {Human (Homo sapiens) [TaxId: 9606]}
kvqtdppsvpicdlypngvfpkgqeceypptqdgrtaawrttseekkaldqaseeiwndf
reaaeahrqvrkyvmswikpgmtmieicekledcsrklikenglnaglafptgcslnnca
ahytpnagdttvlqyddickidfgthisgriidcaftvtfnpkydtllkavkdatntgik
cagidvrlcdvgeaiqevmesyeveidgktyqvkpirnlnghsigqyrihagktvpiikg
geatrmeegevyaietfgstgkgvvXdikgsytaqfehtillrptckevvsrgddy

Timeline for d2ga2a2:

• d2ga2a2 is new in SCOP 1.73
  
• d2ga2a2 appears in SCOP 1.75
  
• d2ga2a2 appears in the current release, SCOPe 2.08