Lineage for d2ga2a2 (2ga2 A:110-374,A:449-478)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. Protein Methionine aminopeptidase [55924] (7 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [55927] (18 PDB entries)
    Uniprot P50579 110-478
    methionine aminopeptidase 2 contains insert domain with a circularly permuted "winged helix" fold
  8. Domain d2ga2a2: 2ga2 A:110-374,A:449-478 [134853]
    Other proteins in same PDB: d2ga2a1
    automated match to d1r58a2
    complexed with a19, mn

Details for d2ga2a2

PDB Entry: 2ga2 (more details), 1.95 Å

PDB Description: h-MetAP2 complexed with A193400
PDB Compounds: (A:) Methionine aminopeptidase 2

SCOPe Domain Sequences for d2ga2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ga2a2 d.127.1.1 (A:110-374,A:449-478) Methionine aminopeptidase {Human (Homo sapiens) [TaxId: 9606]}
kvqtdppsvpicdlypngvfpkgqeceypptqdgrtaawrttseekkaldqaseeiwndf
reaaeahrqvrkyvmswikpgmtmieicekledcsrklikenglnaglafptgcslnnca
ahytpnagdttvlqyddickidfgthisgriidcaftvtfnpkydtllkavkdatntgik
cagidvrlcdvgeaiqevmesyeveidgktyqvkpirnlnghsigqyrihagktvpiikg
geatrmeegevyaietfgstgkgvvXdikgsytaqfehtillrptckevvsrgddy

SCOPe Domain Coordinates for d2ga2a2 are not available.

Timeline for d2ga2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ga2a1