Lineage for d2ga2a1 (2ga2 A:375-448)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634918Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) (S)
    contains a small beta-sheet (wing)
  5. 635410Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein)
    circularly permuted version of the "winged helix" fold
  6. 635411Protein Methionine aminopeptidase, insert domain [46888] (2 species)
  7. 635420Species Human (Homo sapiens) [TaxId:9606] [46890] (16 PDB entries)
  8. 635431Domain d2ga2a1: 2ga2 A:375-448 [134852]
    Other proteins in same PDB: d2ga2a2
    automatically matched to d1b59a1
    complexed with a19, mn

Details for d2ga2a1

PDB Entry: 2ga2 (more details), 1.95 Å

PDB Description: h-MetAP2 complexed with A193400
PDB Compounds: (A:) Methionine aminopeptidase 2

SCOP Domain Sequences for d2ga2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ga2a1 a.4.5.25 (A:375-448) Methionine aminopeptidase, insert domain {Human (Homo sapiens) [TaxId: 9606]}
hddmecshymknfdvghvpirlprtkhllnvinenfgtlafcrrwldrlgeskylmalkn
lcdlgivdpypplc

SCOP Domain Coordinates for d2ga2a1:

Click to download the PDB-style file with coordinates for d2ga2a1.
(The format of our PDB-style files is described here.)

Timeline for d2ga2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ga2a2