![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (17 families) ![]() consists only of helices |
![]() | Family a.4.1.16: Alr1493-like [140216] (1 protein) Pfam PF04255; DUF433; contains extra C-terminal helix and N-terminal dimerisation interlock subdomain (scop_cf 47405) |
![]() | Protein Hypothetical protein Ava_0674 (Alr1493 orthologue) [140217] (1 species) |
![]() | Species Anabaena variabilis [TaxId:1172] [140218] (1 PDB entry) |
![]() | Domain d2ga1a1: 2ga1 A:1-102 [134850] complexed with gol |
PDB Entry: 2ga1 (more details), 2 Å
SCOP Domain Sequences for d2ga1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ga1a1 a.4.1.16 (A:1-102) Hypothetical protein Ava_0674 (Alr1493 orthologue) {Anabaena variabilis [TaxId: 1172]} mnkktqlleviaalpeelvdqalnyvqmlqnpiqitpgvcggqarirntripvwtlvayr qqgapdkellanypgltaedlsaawhyyeqnpeqidreiaqd
Timeline for d2ga1a1: