Lineage for d2ga1a1 (2ga1 A:1-102)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692637Family a.4.1.16: Alr1493-like [140216] (1 protein)
    Pfam PF04255; DUF433; contains extra C-terminal helix and N-terminal dimerisation interlock subdomain (47405)
  6. 2692638Protein Hypothetical protein Ava_0674 (Alr1493 orthologue) [140217] (1 species)
  7. 2692639Species Anabaena variabilis [TaxId:1172] [140218] (1 PDB entry)
    Uniprot Q3MFD8 1-102
  8. 2692640Domain d2ga1a1: 2ga1 A:1-102 [134850]
    Other proteins in same PDB: d2ga1a2
    complexed with gol

Details for d2ga1a1

PDB Entry: 2ga1 (more details), 2 Å

PDB Description: Crystal structure of a duf433 member protein (ava_0674) from anabaena variabilis atcc 29413 at 2.00 A resolution
PDB Compounds: (A:) Protein of unknown function DUF433

SCOPe Domain Sequences for d2ga1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ga1a1 a.4.1.16 (A:1-102) Hypothetical protein Ava_0674 (Alr1493 orthologue) {Anabaena variabilis [TaxId: 1172]}
mnkktqlleviaalpeelvdqalnyvqmlqnpiqitpgvcggqarirntripvwtlvayr
qqgapdkellanypgltaedlsaawhyyeqnpeqidreiaqd

SCOPe Domain Coordinates for d2ga1a1:

Click to download the PDB-style file with coordinates for d2ga1a1.
(The format of our PDB-style files is described here.)

Timeline for d2ga1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ga1a2
View in 3D
Domains from other chains:
(mouse over for more information)
d2ga1b_