Lineage for d2g9ua1 (2g9u A:14-836)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 709765Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 709766Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (9 families) (S)
  5. 709818Family c.87.1.4: Oligosaccharide phosphorylase [53766] (2 proteins)
  6. 709819Protein Glycogen phosphorylase [53767] (3 species)
    both domains are elaborated with many insertions
  7. 709839Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53769] (86 PDB entries)
  8. 709877Domain d2g9ua1: 2g9u A:14-836 [134842]
    automatically matched to d1e1ya_
    complexed with g27, po4

Details for d2g9ua1

PDB Entry: 2g9u (more details), 2.15 Å

PDB Description: The crystal structure of glycogen phosphorylase in complex with (3R,4R,5R)-5-hydroxymethyl-1-(3-phenylpropyl)-piperidine-3,4-diol and phosphate
PDB Compounds: (A:) Glycogen phosphorylase, muscle form

SCOP Domain Sequences for d2g9ua1:

Sequence, based on SEQRES records: (download)

>d2g9ua1 c.87.1.4 (A:14-836) Glycogen phosphorylase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
svrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtqqh
yyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedaglgn
gglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpwekar
peftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapndfn
lkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfks
skfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktca
ytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslvee
gavkrinmahlciagshavngvarihseilkktifkdfyelephkfqnktngitprrwlv
lcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylerey
kvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgy
hmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagtea
sgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyyd
ripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalykn
prewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpa

Sequence, based on observed residues (ATOM records): (download)

>d2g9ua1 c.87.1.4 (A:14-836) Glycogen phosphorylase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
svrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtqqh
yyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedaglgn
gglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpwekar
peftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapndfn
lgyiqavldrnlaenisrvlypngkelrlkqeyfvvaatlqdiirrfksstnfdafpdkv
aiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpealerwpvhlle
tllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlciagshavn
gvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiaerigeeyis
dldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdvqvkrihey
krqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklitaigdvvnhd
pvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlngaltigtmd
ganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieqlssgffspk
qpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirniatsgkfss
drtiaqyareiwgvepsrqrlpa

SCOP Domain Coordinates for d2g9ua1:

Click to download the PDB-style file with coordinates for d2g9ua1.
(The format of our PDB-style files is described here.)

Timeline for d2g9ua1: