| Class g: Small proteins [56992] (100 folds) |
| Fold g.86: Coronavirus NSP10-like [144245] (1 superfamily) binds two zinc ion per subunit; forms a dodecameric shell |
Superfamily g.86.1: Coronavirus NSP10-like [144246] (1 family) ![]() automatically mapped to Pfam PF09401 |
| Family g.86.1.1: Coronavirus NSP10-like [144247] (2 proteins) partly covered by PfamB PB001266 |
| Protein Nonstructural protein 10, NSP10 [144248] (2 species) |
| Species SARS coronavirus [TaxId:227859] [144249] (3 PDB entries) Uniprot P59641 4239-4359! Uniprot P59641 4240-4362 |
| Domain d2g9tq_: 2g9t Q: [134834] automated match to d2g9ta1 complexed with zn |
PDB Entry: 2g9t (more details), 2.1 Å
SCOPe Domain Sequences for d2g9tq_:
Sequence, based on SEQRES records: (download)
>d2g9tq_ g.86.1.1 (Q:) Nonstructural protein 10, NSP10 {SARS coronavirus [TaxId: 227859]}
anstvlsfcafavdpakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesf
ggascclycrchidhpnpkgfcdlkgkyvqipttcandpvgftlrntvctvcgmwkgygc
s
>d2g9tq_ g.86.1.1 (Q:) Nonstructural protein 10, NSP10 {SARS coronavirus [TaxId: 227859]}
anstvlsfcafavdpakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesf
ggascclycrchidhpnfcdlkgkyvqipttcandpvgftlrntvctvcgmwkgygcs
Timeline for d2g9tq_: