Lineage for d2g9tm1 (2g9t M:9-129)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 894637Fold g.86: Coronavirus NSP10-like [144245] (1 superfamily)
    binds two zinc ion per subunit; forms a dodecameric shell
  4. 894638Superfamily g.86.1: Coronavirus NSP10-like [144246] (1 family) (S)
  5. 894639Family g.86.1.1: Coronavirus NSP10-like [144247] (1 protein)
    partly covered by PfamB PB001266
  6. 894640Protein Nonstructural protein 10, NSP10 [144248] (1 species)
  7. 894641Species SARS coronavirus [TaxId:227859] [144249] (3 PDB entries)
    Uniprot P59641 4239-4359! Uniprot P59641 4240-4362
  8. 894655Domain d2g9tm1: 2g9t M:9-129 [134830]
    automatically matched to 2G9T A:9-129
    complexed with zn

Details for d2g9tm1

PDB Entry: 2g9t (more details), 2.1 Å

PDB Description: crystal structure of the sars coronavirus nsp10 at 2.1a
PDB Compounds: (M:) orf1a polyprotein

SCOP Domain Sequences for d2g9tm1:

Sequence, based on SEQRES records: (download)

>d2g9tm1 g.86.1.1 (M:9-129) Nonstructural protein 10, NSP10 {SARS coronavirus [TaxId: 227859]}
anstvlsfcafavdpakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesf
ggascclycrchidhpnpkgfcdlkgkyvqipttcandpvgftlrntvctvcgmwkgygc
s

Sequence, based on observed residues (ATOM records): (download)

>d2g9tm1 g.86.1.1 (M:9-129) Nonstructural protein 10, NSP10 {SARS coronavirus [TaxId: 227859]}
anstvlsfcafavdpakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesf
ggascclycrchidhpnfcdlkgkyvqipttcandpvgftlrntvctvcgmwkgygcs

SCOP Domain Coordinates for d2g9tm1:

Click to download the PDB-style file with coordinates for d2g9tm1.
(The format of our PDB-style files is described here.)

Timeline for d2g9tm1: