SCOPe 2.08: Domain d2g9th_: 2g9t H:

Lineage for d2g9th_ (2g9t H:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.86: Coronavirus NSP10-like [144245] (1 superfamily)
   binds two zinc ion per subunit; forms a dodecameric shell

4. Superfamily g.86.1: Coronavirus NSP10-like [144246] (1 family)
   automatically mapped to Pfam PF09401

5. Family g.86.1.1: Coronavirus NSP10-like [144247] (2 proteins)
   partly covered by PfamB PB001266

6. Protein Nonstructural protein 10, NSP10 [144248] (2 species)

7. Species SARS coronavirus [TaxId:227859] [144249] (3 PDB entries)
   Uniprot P59641 4239-4359! Uniprot P59641 4240-4362

8. Domain d2g9th_: 2g9t H: [134825]
   automated match to d2g9ta1
   complexed with zn

Details for d2g9th_

PDB Entry: 2g9t, 2.1 Å

PDB Description: crystal structure of the sars coronavirus nsp10 at 2.1a

PDB Compounds: (H:) orf1a polyprotein

SCOPe Domain Sequences for d2g9th_:

Sequence, based on SEQRES records:

>d2g9th_ g.86.1.1 (H:) Nonstructural protein 10, NSP10 {SARS coronavirus [TaxId: 227859]}
anstvlsfcafavdpakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesf
ggascclycrchidhpnpkgfcdlkgkyvqipttcandpvgftlrntvctvcgmwkgygc
s

Sequence, based on observed residues (ATOM records):

>d2g9th_ g.86.1.1 (H:) Nonstructural protein 10, NSP10 {SARS coronavirus [TaxId: 227859]}
anstvlsfcafavdpakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesf
ggascclycrchidhpnfcdlkgkyvqipttcandpvgftlrntvctvcgmwkgygcs

Timeline for d2g9th_:

• d2g9th_ first appeared in SCOP 1.73, called d2g9th1
  
• d2g9th_ appears in SCOPe 2.07