Lineage for d2g9nb1 (2g9n B:23-237)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 697477Family c.37.1.19: Tandem AAA-ATPase domain [81268] (22 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 697546Protein Initiation factor 4a [52706] (2 species)
    homologous to UvrB
  7. 697554Species Human (Homo sapiens) [TaxId:9606] [142305] (1 PDB entry)
    4A-I
  8. 697556Domain d2g9nb1: 2g9n B:23-237 [134815]
    automatically matched to 2G9N A:21-238
    complexed with mly

Details for d2g9nb1

PDB Entry: 2g9n (more details), 2.25 Å

PDB Description: Structure of the DEAD domain of Human eukaryotic initiation factor 4A, eIF4A
PDB Compounds: (B:) Eukaryotic initiation factor 4A-I

SCOP Domain Sequences for d2g9nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g9nb1 c.37.1.19 (B:23-237) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]}
iesnwneivdsfddmnlsesllrgiyaygfekpsaiqqrailpcikgydviaqaqsgtgk
tatfaisilqqieldlkatqalvlaptrelaqqiqkvvmalgdymgaschaciggtnvra
evqklqmeaphiivgtpgrvfdmlnrrylspkyikmfvldeademlsrgfkdqiydifqk
lnsntqvvllsatmpsdvlevtkkfmrdpirilvk

SCOP Domain Coordinates for d2g9nb1:

Click to download the PDB-style file with coordinates for d2g9nb1.
(The format of our PDB-style files is described here.)

Timeline for d2g9nb1: