SCOPe 2.08: Domain d2g9ka_: 2g9k A:

Lineage for d2g9ka_ (2g9k A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
   automatically mapped to Pfam PF00576

6. Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (322 PDB entries)
   Uniprot P02766 31-143

8. Domain d2g9ka_: 2g9k A: [134812]
   automated match to d1eta1_
   complexed with ne1

Details for d2g9ka_

PDB Entry: 2g9k, 1.85 Å

PDB Description: Human Transthyretin (TTR) Complexed with Hydroxylated polychlorinated Biphenyl-4-hydroxy-2',3,3',4',5-Pentachlorobiphenyl

PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d2g9ka_:

Sequence; same for both SEQRES and ATOM records:

>d2g9ka_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

Timeline for d2g9ka_:

• d2g9ka_ first appeared in SCOP 1.73, called d2g9ka1
  
• d2g9ka_ appears in SCOPe 2.07