Lineage for d2g9hb1 (2g9h B:93-190)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2358779Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 2358787Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (43 PDB entries)
    Uniprot P04229 30-219
    probably orthologous to the mouse I-E group
  8. 2358804Domain d2g9hb1: 2g9h B:93-190 [134804]
    Other proteins in same PDB: d2g9ha1, d2g9ha2, d2g9hb2, d2g9hd1, d2g9hd2
    automatically matched to d1d5xb1
    complexed with dio, epe, so4, zn

Details for d2g9hb1

PDB Entry: 2g9h (more details), 2 Å

PDB Description: crystal structure of staphylococcal enterotoxin i (sei) in complex with a human mhc class ii molecule
PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d2g9hb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g9hb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

SCOPe Domain Coordinates for d2g9hb1:

Click to download the PDB-style file with coordinates for d2g9hb1.
(The format of our PDB-style files is described here.)

Timeline for d2g9hb1: