Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (41 PDB entries) Uniprot P04229 30-219 probably orthologous to the mouse I-E group |
Domain d2g9hb1: 2g9h B:93-190 [134804] Other proteins in same PDB: d2g9ha1, d2g9ha2, d2g9hb2, d2g9hd1, d2g9hd2 automatically matched to d1d5xb1 complexed with dio, epe, so4, zn |
PDB Entry: 2g9h (more details), 2 Å
SCOPe Domain Sequences for d2g9hb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g9hb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd wtfqtlvmletvprsgevytcqvehpsvtspltvewra
Timeline for d2g9hb1:
View in 3D Domains from other chains: (mouse over for more information) d2g9ha1, d2g9ha2, d2g9hd1, d2g9hd2 |