SCOPe 2.08: Domain d2g9hb1: 2g9h B:93-190

Lineage for d2g9hb1 (2g9h B:93-190)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (43 PDB entries)
   Uniprot P04229 30-219
   probably orthologous to the mouse I-E group

8. Domain d2g9hb1: 2g9h B:93-190 [134804]
   Other proteins in same PDB: d2g9ha1, d2g9ha2, d2g9ha3, d2g9hb2, d2g9hd1, d2g9hd2
   automatically matched to d1d5xb1
   complexed with dio, epe, so4, zn

Details for d2g9hb1

PDB Entry: 2g9h, 2 Å

PDB Description: crystal structure of staphylococcal enterotoxin i (sei) in complex with a human mhc class ii molecule

PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d2g9hb1:

Sequence; same for both SEQRES and ATOM records:

>d2g9hb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Timeline for d2g9hb1:

• d2g9hb1 first appeared in SCOP 1.73
  
• d2g9hb1 appears in SCOPe 2.07