Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (14 PDB entries) |
Domain d2g9ha2: 2g9h A:13-81 [134803] Other proteins in same PDB: d2g9ha1, d2g9hb1, d2g9hb2, d2g9hd1, d2g9hd2 automatically matched to d1k2da2 complexed with dio, epe, so4, zn |
PDB Entry: 2g9h (more details), 2 Å
SCOPe Domain Sequences for d2g9ha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g9ha2 d.19.1.1 (A:13-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]} ylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalaniavdkanlei mtkrsnytp
Timeline for d2g9ha2:
View in 3D Domains from other chains: (mouse over for more information) d2g9hb1, d2g9hb2, d2g9hd1, d2g9hd2 |