Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.29: Extended PAW domain [141113] (1 protein) single domain; the N-terminal half is covered by Pfam PF04721; DUF750 (Smart 00613; PAW), the C-terminal half by PfamB PB028386 |
Protein Peptide:N-glycanase, PNGase, C-terminal domain [141114] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [141115] (3 PDB entries) Uniprot Q9JI78 454-561! Uniprot Q9JI78 472-651 |
Domain d2g9fa1: 2g9f A:472-651 [134800] complexed with cl, gol |
PDB Entry: 2g9f (more details), 1.9 Å
SCOPe Domain Sequences for d2g9fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g9fa1 b.18.1.29 (A:472-651) Peptide:N-glycanase, PNGase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} erkeilfipsenekiskqfhlrydivrdryirvsdnntnisgwengvwkmesifrkvekd wnmvylarkegssfayiswkfecgsaglkvdtvsirtssqsfesgsvrwklrsetaqvnl lgdknlrsyndfsgatevtleaelsrgdgdvawqhtqlfrqslndsgengleiiitfndl
Timeline for d2g9fa1: