![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.241: TraM-like [140580] (1 superfamily) multihelical oligomeric protein; structure of whole subunit is not known; the N-terminal part is implicated in DNA binding, the middle region forms tetrameric parallel coiled coil, surrounded by the C-terminal helices |
![]() | Superfamily a.241.1: TraM-like [140581] (1 family) ![]() |
![]() | Family a.241.1.1: TraM-like [140582] (1 protein) Pfam PF05261 |
![]() | Protein TraM [140583] (1 species) also includes the N-terminal domain structure 1dp3, previously classified into a different family (scop_fa 63566) |
![]() | Species Escherichia coli [TaxId:562] [140584] (2 PDB entries) |
![]() | Domain d2g9ea1: 2g9e A:60-127 [134799] mutant |
PDB Entry: 2g9e (more details), 1.8 Å
SCOP Domain Sequences for d2g9ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g9ea1 a.241.1.1 (A:60-127) TraM {Escherichia coli [TaxId: 562]} afnqtefnklllecvvktqssvakilgilslsphvsgnskfeyanmvedirekvssemer ffpkndde
Timeline for d2g9ea1: