Lineage for d2g9da1 (2g9d A:3-342)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889494Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2889922Family c.56.5.7: AstE/AspA-like [142526] (3 proteins)
    Pfam PF04952; Succinylglutamate desuccinylase / Aspartoacylase family; contains extra C-terminal domain, new variant of the Barrel-sandwich hybrid fold (51229)
  6. 2889938Protein Succinylglutamate desuccinylase AstE [142527] (4 species)
  7. 2889945Species Vibrio cholerae [TaxId:666] [142528] (1 PDB entry)
    Uniprot Q9KSL4 3-342
  8. 2889946Domain d2g9da1: 2g9d A:3-342 [134798]

Details for d2g9da1

PDB Entry: 2g9d (more details), 3 Å

PDB Description: Crystal Structure of Succinylglutamate desuccinylase from Vibrio cholerae, Northeast Structural Genomics Target VcR20
PDB Compounds: (A:) Succinylglutamate desuccinylase

SCOPe Domain Sequences for d2g9da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g9da1 c.56.5.7 (A:3-342) Succinylglutamate desuccinylase AstE {Vibrio cholerae [TaxId: 666]}
kslfrqsflfdsldldhpmvaqtvrteqgvtlklhqrgvlevipaqtdaatknmviscgi
hgdetapmelldkwiddivsgfqpvaerclfimahpqatvrhvrfieqnlnrlfddkpht
pstelaiadnlkvllrqffantdehsrwhldlhcairgskhysfavspkarhpvrsrslm
qfieqahieavmlsnapsstfswysaehyaaqaltlelgqvarlgenlldrllafdlamr
dlisrhkpehlprksvmyrvsrtivrlhddfdfrfsddvenftafmhgevfghdgdkplm
aknegeaivfpnrkvaigqraalmvckvntryeddqlvyd

SCOPe Domain Coordinates for d2g9da1:

Click to download the PDB-style file with coordinates for d2g9da1.
(The format of our PDB-style files is described here.)

Timeline for d2g9da1: