Class b: All beta proteins [48724] (176 folds) |
Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) |
Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins) |
Protein automated matches [254533] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255181] (2 PDB entries) |
Domain d2g98b1: 2g98 B:1-85 [134796] automated match to d1h4ax1 |
PDB Entry: 2g98 (more details), 2.2 Å
SCOPe Domain Sequences for d2g98b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g98b1 b.11.1.1 (B:1-85) automated matches {Human (Homo sapiens) [TaxId: 9606]} gkitlyedrgfqgrhyecssdhpnlqpylsrcnsasvdsgcwmlyeqpnysglqyflrrg dyadhqqwmglsdsvrscrliphsg
Timeline for d2g98b1: