Lineage for d2g98b1 (2g98 B:1-85)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 661690Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 661691Superfamily b.11.1: gamma-Crystallin-like [49695] (6 families) (S)
  5. 661692Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins)
  6. 661730Protein gamma-Crystallin [49697] (7 species)
    duplication consists of two domains of this fold
  7. 661760Species Human (Homo sapiens), isoform D [TaxId:9606] [89230] (3 PDB entries)
  8. 661767Domain d2g98b1: 2g98 B:1-85 [134796]
    automatically matched to d1h4ax1

Details for d2g98b1

PDB Entry: 2g98 (more details), 2.2 Å

PDB Description: human gamma-d-crystallin
PDB Compounds: (B:) gamma crystallin d

SCOP Domain Sequences for d2g98b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g98b1 b.11.1.1 (B:1-85) gamma-Crystallin {Human (Homo sapiens), isoform D [TaxId: 9606]}
gkitlyedrgfqgrhyecssdhpnlqpylsrcnsasvdsgcwmlyeqpnysglqyflrrg
dyadhqqwmglsdsvrscrliphsg

SCOP Domain Coordinates for d2g98b1:

Click to download the PDB-style file with coordinates for d2g98b1.
(The format of our PDB-style files is described here.)

Timeline for d2g98b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g98b2