SCOP 1.73: Domain d2g98b1: 2g98 B:1-85

Lineage for d2g98b1 (2g98 B:1-85)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (6 families)

5. Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins)

6. Protein gamma-Crystallin [49697] (7 species)
   duplication consists of two domains of this fold

7. Species Human (Homo sapiens), isoform D [TaxId:9606] [89230] (3 PDB entries)

8. Domain d2g98b1: 2g98 B:1-85 [134796]
   automatically matched to d1h4ax1

Details for d2g98b1

PDB Entry: 2g98, 2.2 Å

PDB Description: human gamma-d-crystallin

PDB Compounds: (B:) gamma crystallin d

SCOP Domain Sequences for d2g98b1:

Sequence; same for both SEQRES and ATOM records:

>d2g98b1 b.11.1.1 (B:1-85) gamma-Crystallin {Human (Homo sapiens), isoform D [TaxId: 9606]}
gkitlyedrgfqgrhyecssdhpnlqpylsrcnsasvdsgcwmlyeqpnysglqyflrrg
dyadhqqwmglsdsvrscrliphsg

Timeline for d2g98b1:

• d2g98b1 is new in SCOP 1.73
  
• d2g98b1 appears in SCOP 1.75
  
• d2g98b1 appears in the current release, SCOPe 2.08