![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
![]() | Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) ![]() |
![]() | Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins) |
![]() | Protein automated matches [254533] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255181] (4 PDB entries) |
![]() | Domain d2g98a1: 2g98 A:1-85 [134794] automated match to d1h4ax1 |
PDB Entry: 2g98 (more details), 2.2 Å
SCOPe Domain Sequences for d2g98a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g98a1 b.11.1.1 (A:1-85) automated matches {Human (Homo sapiens) [TaxId: 9606]} gkitlyedrgfqgrhyecssdhpnlqpylsrcnsasvdsgcwmlyeqpnysglqyflrrg dyadhqqwmglsdsvrscrliphsg
Timeline for d2g98a1: