SCOP 1.73: Domain d2g94d1: 2g94 D:45P-385

Lineage for d2g94d1 (2g94 D:45P-385)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.2: Pepsin-like [50646] (10 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein beta-secretase (memapsin) [50671] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50672] (30 PDB entries)

8. Domain d2g94d1: 2g94 D:45P-385 [134793]
   automatically matched to d1fkna_
   complexed with zpq

Details for d2g94d1

PDB Entry: 2g94, 1.86 Å

PDB Description: Crystal structure of beta-secretase bound to a potent and highly selective inhibitor.

PDB Compounds: (D:) Beta-secretase 1

SCOP Domain Sequences for d2g94d1:

Sequence; same for both SEQRES and ATOM records:

>d2g94d1 b.50.1.2 (D:45P-385) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
gsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrql
sstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwe
gilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmii
ggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrl
pkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsf
ritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfav
sachvhdefrtaavegpfvtldmedcgyn

Timeline for d2g94d1:

• d2g94d1 is new in SCOP 1.73
  
• d2g94d1 appears in SCOP 1.75
  
• d2g94d1 appears in the current release, SCOPe 2.08, called d2g94d_