SCOPe 2.01: Domain d2g8va_: 2g8v A:

Lineage for d2g8va_ (2g8v A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein BH0863-like Ribonuclease H [142490] (3 species)
   new class of RNase H

7. Species Bacillus halodurans [TaxId:86665] [142491] (12 PDB entries)
   Uniprot Q9KEI9 61-193! Uniprot Q9KEI9 62-193
   BH0863

8. Domain d2g8va_: 2g8v A: [134787]
   automated match to d2g8fa1
   protein/DNA complex; protein/RNA complex; complexed with eoh, mg; mutant

Details for d2g8va_

PDB Entry: 2g8v, 1.85 Å

PDB Description: b. halodurans rnase h catalytic domain e188a mutant in complex with mg2+ and rna/dna hybrid (reaction product)

PDB Compounds: (A:) Ribonuclease H

SCOPe Domain Sequences for d2g8va_:

Sequence; same for both SEQRES and ATOM records:

>d2g8va_ c.55.3.1 (A:) BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 86665]}
eeiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglryl
kernsrkpiysdsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilk
wqtdkwgaikady

Timeline for d2g8va_:

• d2g8va_ first appeared in SCOP 1.73, called d2g8va1
  
• d2g8va_ was called d2g8va1 in SCOP 1.75
  
• d2g8va_ appears in SCOPe 2.02
  
• d2g8va_ appears in the current release, SCOPe 2.08