Lineage for d2g8va1 (2g8v A:61-193)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701966Superfamily c.55.3: Ribonuclease H-like [53098] (12 families) (S)
    consists of one domain of this fold
  5. 701967Family c.55.3.1: Ribonuclease H [53099] (4 proteins)
  6. 701968Protein BH0863-like Ribonuclease H [142490] (1 species)
    new class of RNase H
  7. 701969Species Bacillus halodurans [TaxId:86665] [142491] (10 PDB entries)
    BH0863
  8. 701974Domain d2g8va1: 2g8v A:61-193 [134787]
    automatically matched to 2G8F A:61-193
    complexed with eoh, mg; mutant

Details for d2g8va1

PDB Entry: 2g8v (more details), 1.85 Å

PDB Description: b. halodurans rnase h catalytic domain e188a mutant in complex with mg2+ and rna/dna hybrid (reaction product)
PDB Compounds: (A:) Ribonuclease H

SCOP Domain Sequences for d2g8va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g8va1 c.55.3.1 (A:61-193) BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 86665]}
eeiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglryl
kernsrkpiysdsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilk
wqtdkwgaikady

SCOP Domain Coordinates for d2g8va1:

Click to download the PDB-style file with coordinates for d2g8va1.
(The format of our PDB-style files is described here.)

Timeline for d2g8va1: