Lineage for d2g8ua_ (2g8u A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 995076Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 995888Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 995889Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 995890Protein BH0863-like Ribonuclease H [142490] (3 species)
    new class of RNase H
  7. 995891Species Bacillus halodurans [TaxId:86665] [142491] (12 PDB entries)
    Uniprot Q9KEI9 61-193! Uniprot Q9KEI9 62-193
    BH0863
  8. 995905Domain d2g8ua_: 2g8u A: [134786]
    automated match to d1zbfa1
    protein/DNA complex; protein/RNA complex; complexed with mg; mutant

Details for d2g8ua_

PDB Entry: 2g8u (more details), 2.7 Å

PDB Description: b. halodurans rnase h catalytic domain d132n mutant in complex with mg2+ and rna/dna hybrid (non-p nick at the active site)
PDB Compounds: (A:) Ribonuclease H

SCOPe Domain Sequences for d2g8ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g8ua_ c.55.3.1 (A:) BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 86665]}
eiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglrylk
ernsrkpiysnsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilkw
qtdkwgeikady

SCOPe Domain Coordinates for d2g8ua_:

Click to download the PDB-style file with coordinates for d2g8ua_.
(The format of our PDB-style files is described here.)

Timeline for d2g8ua_: