Lineage for d2g8ra_ (2g8r A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535185Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2535186Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2535187Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2535659Protein automated matches [190061] (7 species)
    not a true protein
  7. 2535662Species Cow (Bos taurus) [TaxId:9913] [186780] (71 PDB entries)
  8. 2535692Domain d2g8ra_: 2g8r A: [134783]
    automated match to d1a2wa_
    complexed with n3e

Details for d2g8ra_

PDB Entry: 2g8r (more details), 1.7 Å

PDB Description: The crystal structure of the RNase A- 3-N-piperidine-4-carboxyl-3-deoxy-ara-uridine complex
PDB Compounds: (A:) ribonuclease pancreatic

SCOPe Domain Sequences for d2g8ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g8ra_ d.5.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOPe Domain Coordinates for d2g8ra_:

Click to download the PDB-style file with coordinates for d2g8ra_.
(The format of our PDB-style files is described here.)

Timeline for d2g8ra_: