Lineage for d2g8ob1 (2g8o B:1-264)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 732217Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 732218Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) (S)
  5. 732219Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins)
  6. 732247Protein Thymidylate synthase [55833] (7 species)
  7. 732262Species Escherichia coli [TaxId:562] [55834] (52 PDB entries)
  8. 732264Domain d2g8ob1: 2g8o B:1-264 [134780]
    automatically matched to d1tlca_
    complexed with cb3, ump

Details for d2g8ob1

PDB Entry: 2g8o (more details), 1.3 Å

PDB Description: High resolution structure of Escherichia coli thymidylate synthase ternary complex with dUMP and a cofactor analog, CB3717
PDB Compounds: (B:) Thymidylate synthase

SCOP Domain Sequences for d2g8ob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g8ob1 d.117.1.1 (B:1-264) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

SCOP Domain Coordinates for d2g8ob1:

Click to download the PDB-style file with coordinates for d2g8ob1.
(The format of our PDB-style files is described here.)

Timeline for d2g8ob1: