Lineage for d2g8nb1 (2g8n B:18-280)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 839581Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 839582Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (57 families) (S)
  5. 839783Family c.66.1.15: Arylamine N-methyltransferase [69547] (2 proteins)
  6. 839787Protein Phenylethanolamine N-methyltransferase, PNMTase [69548] (1 species)
  7. 839788Species Human (Homo sapiens) [TaxId:9606] [69549] (12 PDB entries)
  8. 839792Domain d2g8nb1: 2g8n B:18-280 [134778]
    automatically matched to d1hnnb_
    complexed with f83, sah

Details for d2g8nb1

PDB Entry: 2g8n (more details), 2.15 Å

PDB Description: Structure of hPNMT with inhibitor 3-Hydroxymethyl-7-(N-4-chlorophenylaminosulfonyl)-THIQ and AdoHcy
PDB Compounds: (B:) Phenylethanolamine N-methyltransferase

SCOP Domain Sequences for d2g8nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g8nb1 c.66.1.15 (B:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]}
pgqaavasayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgrtlid
igsgptvyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacliegkg
ecwqdkerqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlasfqra
ldhittllrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdlrtyi
mpahlqtgvddvkgvffawaqkv

SCOP Domain Coordinates for d2g8nb1:

Click to download the PDB-style file with coordinates for d2g8nb1.
(The format of our PDB-style files is described here.)

Timeline for d2g8nb1: