Lineage for d2g8na_ (2g8n A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893229Family c.66.1.15: Arylamine N-methyltransferase [69547] (3 proteins)
    automatically mapped to Pfam PF01234
  6. 2893251Protein automated matches [190168] (1 species)
    not a true protein
  7. 2893252Species Human (Homo sapiens) [TaxId:9606] [186895] (34 PDB entries)
  8. 2893253Domain d2g8na_: 2g8n A: [134777]
    Other proteins in same PDB: d2g8nb3
    automated match to d1hnnb_
    complexed with f83, sah

Details for d2g8na_

PDB Entry: 2g8n (more details), 2.15 Å

PDB Description: Structure of hPNMT with inhibitor 3-Hydroxymethyl-7-(N-4-chlorophenylaminosulfonyl)-THIQ and AdoHcy
PDB Compounds: (A:) Phenylethanolamine N-methyltransferase

SCOPe Domain Sequences for d2g8na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g8na_ c.66.1.15 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vasayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgrtlidigsgp
tvyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacliegkgecwqd
kerqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlasfqraldhit
tllrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdlrtyimpahl
qtgvddvkgvffawaqkv

SCOPe Domain Coordinates for d2g8na_:

Click to download the PDB-style file with coordinates for d2g8na_.
(The format of our PDB-style files is described here.)

Timeline for d2g8na_: