SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2g8ka_ (2g8k A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2123752Family c.55.3.1: Ribonuclease H [53099] (5 protein domains)
  6. 2123753Protein BH0863-like Ribonuclease H [142490] (3 species)
    new class of RNase H
  7. 2123754Species Bacillus halodurans [TaxId:86665] [142491] (21 PDB entries)
    Uniprot Q9KEI9 61-193! Uniprot Q9KEI9 62-193
    BH0863
  8. 2123761Domain d2g8ka_: 2g8k A: [134774]
    automated match to d1zbla1
    protein/DNA complex; protein/RNA complex; complexed with ca; mutant

Details for d2g8ka_

PDB Entry: 2g8k (more details), 1.65 Å

PDB Description: B. halodurans RNase H catalytic domain D192N mutant in complex with Ca2+ and RNA/DNA hybrid (non-P nick at the active site)
PDB Compounds: (A:) Ribonuclease H

SCOPe Domain Sequences for d2g8ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g8ka_ c.55.3.1 (A:) BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 86665]}
eeiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglryl
kernsrkpiysdsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilk
wqtdkwgeikanygrk

SCOPe Domain Coordinates for d2g8ka_:

Click to download the PDB-style file with coordinates for d2g8ka_.
(The format of our PDB-style files is described here.)

Timeline for d2g8ka_: