Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein) automatically mapped to Pfam PF00648 |
Protein Calpain large subunit, catalytic domain (domain II) [54041] (6 species) includes the N-terminal 'sequence' domain I |
Species Norway rat (Rattus norvegicus), mu-type [TaxId:10116] [75332] (10 PDB entries) Uniprot P97571 33-353 |
Domain d2g8ja_: 2g8j A: [134773] automated match to d1tloa_ complexed with ca, d7g |
PDB Entry: 2g8j (more details), 1.61 Å
SCOPe Domain Sequences for d2g8ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g8ja_ d.3.1.3 (A:) Calpain large subunit, catalytic domain (domain II) {Norway rat (Rattus norvegicus), mu-type [TaxId: 10116]} naikylgqdyenlrarclqngvlfqddafppvshslgfkelgpnssktygikwkrptell snpqfivdgatrtdicqgalgdcwllaaiasltlnetilhrvvpygqsfqegyagifhfq lwqfgewvdvvvddllptkdgklvfvhsaqgnefwsallekayakvngsyealsggctse afedftggvtewydlqkapsdlyqiilkalergsllgcsinisdirdleaitfknlvrgh aysvtdakqvtyqgqrvnlirmrnpwgevewkgpwsdnsyewnkvdpyereqlrvkmedg efwmsfrdfireftkleicnlt
Timeline for d2g8ja_: