Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (16 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein) |
Protein Calpain large subunit, catalytic domain (domain II) [54041] (5 species) includes the N-terminal 'sequence' domain I |
Species Rat (Rattus norvegicus), mu-type [TaxId:10116] [75332] (8 PDB entries) |
Domain d2g8ja1: 2g8j A:33-354 [134773] automatically matched to d1tloa_ complexed with ca, d7g |
PDB Entry: 2g8j (more details), 1.61 Å
SCOP Domain Sequences for d2g8ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g8ja1 d.3.1.3 (A:33-354) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} naikylgqdyenlrarclqngvlfqddafppvshslgfkelgpnssktygikwkrptell snpqfivdgatrtdicqgalgdcwllaaiasltlnetilhrvvpygqsfqegyagifhfq lwqfgewvdvvvddllptkdgklvfvhsaqgnefwsallekayakvngsyealsggctse afedftggvtewydlqkapsdlyqiilkalergsllgcsinisdirdleaitfknlvrgh aysvtdakqvtyqgqrvnlirmrnpwgevewkgpwsdnsyewnkvdpyereqlrvkmedg efwmsfrdfireftkleicnlt
Timeline for d2g8ja1: