SCOPe 2.08: Domain d2g87b_: 2g87 B:

Lineage for d2g87b_ (2g87 B:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families)
   Pfam PF13853. Phylogeny described in PubMed 12761335

5. Family f.13.1.2: Rhodopsin-like [81320] (2 proteins)
   Individual TM segments have a number of kinks and distortions

6. Protein automated matches [190300] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [188510] (18 PDB entries)

8. Domain d2g87b_: 2g87 B: [134768]
   automated match to d1f88a_
   complexed with hg, htg, hto, plm, ret, zn

Details for d2g87b_

PDB Entry: 2g87, 2.6 Å

PDB Description: crystallographic model of bathorhodopsin

PDB Compounds: (B:) rhodopsin

SCOPe Domain Sequences for d2g87b_:

Sequence; same for both SEQRES and ATOM records:

>d2g87b_ f.13.1.2 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mngtegpnfyvpfsnktgvvrspfeapqyylaepwqfsmlaaymfllimlgfpinfltly
vtvqhkklrtplnyillnlavadlfmvfggftttlytslhgyfvfgptgcnlegffatlg
geialwslvvlaieryvvvckpmsnfrfgenhaimgvaftwvmalacaapplvgwsryip
egmqcscgidyytpheetnnesfviymfvvhfiipliviffcygqlvftvkeaaaqqqes
attqkaekevtrmviimviaflicwlpyagvafyifthqgsdfgpifmtipaffaktsav
ynpviyimmnkqfrncmvttlccgknplgddeasttvsktetsqvapa

Timeline for d2g87b_:

• d2g87b_ first appeared in SCOP 1.73, called d2g87b1
  
• d2g87b_ appears in SCOPe 2.07