SCOP 1.73: Domain d2g83b2: 2g83 B:33-60,B:182-345

Lineage for d2g83b2 (2g83 B:33-60,B:182-345)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (3 species)
   common fold is interrupted with an all-alpha domain

7. Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (26 PDB entries)

8. Domain d2g83b2: 2g83 B:33-60,B:182-345 [134765]
   Other proteins in same PDB: d2g83a1, d2g83b1
   automatically matched to d1kjya2
   complexed with alf, gdp, mg

Details for d2g83b2

PDB Entry: 2g83, 2.8 Å

PDB Description: Structure of activated G-alpha-i1 bound to a nucleotide-state-selective peptide: Minimal determinants for recognizing the active form of a G protein alpha subunit

PDB Compounds: (B:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOP Domain Sequences for d2g83b2:

Sequence; same for both SEQRES and ATOM records:

>d2g83b2 c.37.1.8 (B:33-60,B:182-345) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]}
evkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkwi
hcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkd
lfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknv
qfvfdavtdviik

Timeline for d2g83b2:

• d2g83b2 is new in SCOP 1.73
  
• d2g83b2 appears in SCOP 1.75
  
• d2g83b2 appears in the current release, SCOPe 2.08