Lineage for d2g83b1 (2g83 B:61-181)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 917893Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
    5 helices; folded leaf
  4. 917894Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
    this domain interrupts the G-protein common fold
  5. 917895Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 917896Protein Transducin (alpha subunit), insertion domain [47897] (4 species)
  7. 917930Species Norway rat (Rattus norvegicus) [TaxId:10116] [47899] (24 PDB entries)
  8. 917960Domain d2g83b1: 2g83 B:61-181 [134764]
    Other proteins in same PDB: d2g83a2, d2g83b2
    automatically matched to d1kjya1
    complexed with alf, gdp, mg

Details for d2g83b1

PDB Entry: 2g83 (more details), 2.8 Å

PDB Description: Structure of activated G-alpha-i1 bound to a nucleotide-state-selective peptide: Minimal determinants for recognizing the active form of a G protein alpha subunit
PDB Compounds: (B:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOPe Domain Sequences for d2g83b1:

Sequence, based on SEQRES records: (download)

>d2g83b1 a.66.1.1 (B:61-181) Transducin (alpha subunit), insertion domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

Sequence, based on observed residues (ATOM records): (download)

>d2g83b1 a.66.1.1 (B:61-181) Transducin (alpha subunit), insertion domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlaelagvikrl
wkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvkt

SCOPe Domain Coordinates for d2g83b1:

Click to download the PDB-style file with coordinates for d2g83b1.
(The format of our PDB-style files is described here.)

Timeline for d2g83b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g83b2