Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species) |
Species Thermus aquaticus [TaxId:271] [55352] (2 PDB entries) |
Domain d2g82r2: 2g82 R:149-310 [134761] Other proteins in same PDB: d2g82a1, d2g82b1, d2g82c1, d2g82d1, d2g82o1, d2g82p1, d2g82q1, d2g82r1 automated match to d1cero2 complexed with gol, ipa, na, nad, pge |
PDB Entry: 2g82 (more details), 1.65 Å
SCOPe Domain Sequences for d2g82r2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g82r2 d.81.1.1 (R:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} cttnslapvmkvleeafgvekalmttvhsytndqrlldlphkdlrraraaainiiptttg aakatalvlpslkgrfdgmalrvptatgsisditallkrevtaeevnaalkaaaegplkg ilaytedeivlqdivmdphssivdakltkalgnmvkvfawyd
Timeline for d2g82r2: