Lineage for d2g82o2 (2g82 O:149-310)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2961609Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2961610Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2961611Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 2961702Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (21 species)
  7. 2961888Species Thermus aquaticus [TaxId:271] [55352] (2 PDB entries)
  8. 2961893Domain d2g82o2: 2g82 O:149-310 [134755]
    Other proteins in same PDB: d2g82a1, d2g82b1, d2g82c1, d2g82d1, d2g82o1, d2g82p1, d2g82q1, d2g82r1
    automated match to d1cero2
    complexed with gol, ipa, na, nad, pge

Details for d2g82o2

PDB Entry: 2g82 (more details), 1.65 Å

PDB Description: High Resolution Structures of Thermus aquaticus Glyceraldehyde-3-Phosphate Dehydrogenase: Role of 220's Loop Motion in Catalysis
PDB Compounds: (O:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d2g82o2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g82o2 d.81.1.1 (O:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]}
cttnslapvmkvleeafgvekalmttvhsytndqrlldlphkdlrraraaainiiptttg
aakatalvlpslkgrfdgmalrvptatgsisditallkrevtaeevnaalkaaaegplkg
ilaytedeivlqdivmdphssivdakltkalgnmvkvfawyd

SCOPe Domain Coordinates for d2g82o2:

Click to download the PDB-style file with coordinates for d2g82o2.
(The format of our PDB-style files is described here.)

Timeline for d2g82o2: