Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species) |
Species Thermus aquaticus [TaxId:271] [51804] (2 PDB entries) |
Domain d2g82o1: 2g82 O:1-148,O:311-330 [134754] Other proteins in same PDB: d2g82a2, d2g82b2, d2g82c2, d2g82d2, d2g82o2, d2g82p2, d2g82q2, d2g82r2 automated match to d1cero1 complexed with gol, ipa, na, nad, pge |
PDB Entry: 2g82 (more details), 1.65 Å
SCOPe Domain Sequences for d2g82o1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g82o1 c.2.1.3 (O:1-148,O:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa kgeditivmgvnheaydpsrhhiisnasXnewgyanrvadlvelvlrkg
Timeline for d2g82o1: