SCOP 1.75: Domain d2g82c2: 2g82 C:149-310

Lineage for d2g82c2 (2g82 C:149-310)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)

7. Species Thermus aquaticus [TaxId:271] [55352] (2 PDB entries)

8. Domain d2g82c2: 2g82 C:149-310 [134751]
   Other proteins in same PDB: d2g82a1, d2g82b1, d2g82c1, d2g82d1, d2g82o1, d2g82p1, d2g82q1, d2g82r1
   automatically matched to d1cero2
   complexed with gol, ipa, na, nad, pge

Details for d2g82c2

PDB Entry: 2g82, 1.65 Å

PDB Description: High Resolution Structures of Thermus aquaticus Glyceraldehyde-3-Phosphate Dehydrogenase: Role of 220's Loop Motion in Catalysis

PDB Compounds: (C:) glyceraldehyde-3-phosphate dehydrogenase

SCOP Domain Sequences for d2g82c2:

Sequence; same for both SEQRES and ATOM records:

>d2g82c2 d.81.1.1 (C:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]}
cttnslapvmkvleeafgvekalmttvhsytndqrlldlphkdlrraraaainiiptttg
aakatalvlpslkgrfdgmalrvptatgsisditallkrevtaeevnaalkaaaegplkg
ilaytedeivlqdivmdphssivdakltkalgnmvkvfawyd

Timeline for d2g82c2:

• d2g82c2 first appeared in SCOP 1.73
  
• d2g82c2 appears in SCOPe 2.01
  
• d2g82c2 appears in the current release, SCOPe 2.08