Lineage for d2g82c1 (2g82 C:1-148,C:311-330)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2104791Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2105032Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (20 species)
  7. 2105210Species Thermus aquaticus [TaxId:271] [51804] (2 PDB entries)
  8. 2105213Domain d2g82c1: 2g82 C:1-148,C:311-330 [134750]
    Other proteins in same PDB: d2g82a2, d2g82b2, d2g82c2, d2g82d2, d2g82o2, d2g82p2, d2g82q2, d2g82r2
    automated match to d1cero1
    complexed with gol, ipa, na, nad, pge

Details for d2g82c1

PDB Entry: 2g82 (more details), 1.65 Å

PDB Description: High Resolution Structures of Thermus aquaticus Glyceraldehyde-3-Phosphate Dehydrogenase: Role of 220's Loop Motion in Catalysis
PDB Compounds: (C:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d2g82c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g82c1 c.2.1.3 (C:1-148,C:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]}
mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
kgeditivmgvnheaydpsrhhiisnasXnewgyanrvadlvelvlrkg

SCOPe Domain Coordinates for d2g82c1:

Click to download the PDB-style file with coordinates for d2g82c1.
(The format of our PDB-style files is described here.)

Timeline for d2g82c1: