SCOP 1.73: Domain d2g82b1: 2g82 B:1-148,B:311-330

Lineage for d2g82b1 (2g82 B:1-148,B:311-330)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (18 species)

7. Species Thermus aquaticus [TaxId:271] [51804] (2 PDB entries)

8. Domain d2g82b1: 2g82 B:1-148,B:311-330 [134748]
   Other proteins in same PDB: d2g82a2, d2g82b2, d2g82c2, d2g82d2, d2g82o2, d2g82p2, d2g82q2, d2g82r2
   automatically matched to d1cero1
   complexed with gol, ipa, na, nad, pge

Details for d2g82b1

PDB Entry: 2g82, 1.65 Å

PDB Description: High Resolution Structures of Thermus aquaticus Glyceraldehyde-3-Phosphate Dehydrogenase: Role of 220's Loop Motion in Catalysis

PDB Compounds: (B:) glyceraldehyde-3-phosphate dehydrogenase

SCOP Domain Sequences for d2g82b1:

Sequence; same for both SEQRES and ATOM records:

>d2g82b1 c.2.1.3 (B:1-148,B:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]}
mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
kgeditivmgvnheaydpsrhhiisnasXnewgyanrvadlvelvlrkg

Timeline for d2g82b1:

• d2g82b1 is new in SCOP 1.73
  
• d2g82b1 appears in SCOP 1.75
  
• d2g82b1 appears in the current release, SCOPe 2.08