Lineage for d2g81e_ (2g81 E:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1793331Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 1794264Protein Trypsin(ogen) [50515] (9 species)
  7. 1794282Species Cow (Bos taurus) [TaxId:9913] [50516] (396 PDB entries)
    Uniprot P00760
  8. 1794368Domain d2g81e_: 2g81 E: [134745]
    Other proteins in same PDB: d2g81i1
    automated match to d1aq7__
    complexed with acy, ca, edo, p6g, pge, so4

Details for d2g81e_

PDB Entry: 2g81 (more details), 1.55 Å

PDB Description: Crystal Structure of the Bowman-Birk Inhibitor from Vigna unguiculata Seeds in Complex with Beta-trypsin at 1.55 Angstrons Resolution
PDB Compounds: (E:) cationic trypsin

SCOPe Domain Sequences for d2g81e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g81e_ b.47.1.2 (E:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d2g81e_:

Click to download the PDB-style file with coordinates for d2g81e_.
(The format of our PDB-style files is described here.)

Timeline for d2g81e_: