Lineage for d2g80c_ (2g80 C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526731Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2526732Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2527491Family c.108.1.22: Enolase-phosphatase E1 [142186] (3 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 2527496Protein Protein UTR4 [142187] (1 species)
  7. 2527497Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [142188] (1 PDB entry)
    Uniprot P32626 17-241
  8. 2527500Domain d2g80c_: 2g80 C: [134743]
    automated match to d2g80a1
    complexed with gol, mg, pe4

Details for d2g80c_

PDB Entry: 2g80 (more details), 2.28 Å

PDB Description: Crystal structure of UTR4 protein (Unknown transcript 4 protein) (yel038w) from Saccharomyces cerevisiae at 2.28 A resolution
PDB Compounds: (C:) Protein UTR4

SCOPe Domain Sequences for d2g80c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g80c_ c.108.1.22 (C:) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nystylldiegtvcpisfvketlfpyftnkvpqlvqqdtrdspvsnilsqfhidnkeqlq
ahilelvakdvkdpilkqlqgyvwahgyesgqikapvyadaidfikrkkrvfiyssgsvk
aqkllfgyvqdpnapahdsldlnsyidgyfdintsgkktetqsyanilrdigakasevlf
lsdnpleldaaagvgiatglasrpgnapvpdgqkyqvyknfetl

SCOPe Domain Coordinates for d2g80c_:

Click to download the PDB-style file with coordinates for d2g80c_.
(The format of our PDB-style files is described here.)

Timeline for d2g80c_: