SCOPe 2.01: Domain d2g80c1: 2g80 C:18-241

Lineage for d2g80c1 (2g80 C:18-241)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.22: Enolase-phosphatase E1 [142186] (3 proteins)
   the insertion subdomain is a 4-helical bundle

6. Protein Protein UTR4 [142187] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [142188] (1 PDB entry)
   Uniprot P32626 17-241

8. Domain d2g80c1: 2g80 C:18-241 [134743]
   automatically matched to 2G80 A:17-241
   complexed with gol, mg, pe4

Details for d2g80c1

PDB Entry: 2g80, 2.28 Å

PDB Description: Crystal structure of UTR4 protein (Unknown transcript 4 protein) (yel038w) from Saccharomyces cerevisiae at 2.28 A resolution

PDB Compounds: (C:) Protein UTR4

SCOPe Domain Sequences for d2g80c1:

Sequence; same for both SEQRES and ATOM records:

>d2g80c1 c.108.1.22 (C:18-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nystylldiegtvcpisfvketlfpyftnkvpqlvqqdtrdspvsnilsqfhidnkeqlq
ahilelvakdvkdpilkqlqgyvwahgyesgqikapvyadaidfikrkkrvfiyssgsvk
aqkllfgyvqdpnapahdsldlnsyidgyfdintsgkktetqsyanilrdigakasevlf
lsdnpleldaaagvgiatglasrpgnapvpdgqkyqvyknfetl

Timeline for d2g80c1:

• d2g80c1 first appeared in SCOP 1.73
  
• d2g80c1 appears in SCOP 1.75
  
• d2g80c1 appears in SCOPe 2.02
  
• d2g80c1 appears in the current release, SCOPe 2.08, called d2g80c_